PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr6P05990_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 603aa    MW: 67395.1 Da    PI: 7.3085
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr6P05990_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.85.1e-201671156
                           TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                           +++ +++t+ q++eLe++F+ +++p++++r +L++ l L+ rq+k+WFqNrR+++k
  GSMUA_Achr6P05990_001 16 KKRYHRHTPRQIQELESMFKVCPHPDEKQRMQLSRDLALEPRQIKFWFQNRRTQMK 71
                           688999***********************************************998 PP

2START155.54.4e-492004233206
                            HHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S... CS
                  START   3 aeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla... 77 
                            a  aa+e++++++ ++p+Wvks     + ++ +++ + f++s+        ++e++r+s+ v m++++l   ++d + +W e ++   
  GSMUA_Achr6P05990_001 200 ATGAAEEVLRLVQTDQPLWVKSGsdgrDRLQLEIYDRMFQRSGQhlrfphTRTETSRDSAPVAMNAMTLIDMFMDAS-KWAELFPsiv 286
                            567899****************9999977777777777766666899******************************.******9999 PP

                            .EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEE CS
                  START  78 .kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepk 157
                             ka t+ev+  g      g l+lm+ elq+lsplvp R+f f+Ry++q + g wv++dvSvd +++++    + R+++lpSg+lie++
  GSMUA_Achr6P05990_001 287 aKARTIEVLAAGmassrsGSLVLMYEELQVLSPLVPtREFCFLRYCQQIESGMWVVADVSVDYPRDNQ-LGLSPRSRRLPSGCLIEET 373
                            9******************************************************************9.68889999*********** PP

                            CTCEEEEEEEE-EE--SS.XXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                  START 158 snghskvtwvehvdlkgr.lphwllrslvksglaegaktwvatlqrqcek 206
                            ++g+sk+twveh++ +++ +ph l++ l++sg+a+ga++w  tl+r ce+
  GSMUA_Achr6P05990_001 374 PDGYSKITWVEHMEIDANdQPHVLFKDLINSGTAFGAQRWITTLRRMCER 423
                            ****************86489***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-21472IPR009057Homeodomain-like
SuperFamilySSF466892.99E-19771IPR009057Homeodomain-like
PROSITE profilePS5007117.0861373IPR001356Homeobox domain
SMARTSM003891.1E-171477IPR001356Homeobox domain
CDDcd000867.30E-171671No hitNo description
PfamPF000461.5E-171671IPR001356Homeobox domain
PROSITE patternPS0002704871IPR017970Homeobox, conserved site
PROSITE profilePS5084851.263189426IPR002913START domain
SuperFamilySSF559618.25E-37191424No hitNo description
CDDcd088751.18E-100193422No hitNo description
SMARTSM002349.1E-40198423IPR002913START domain
PfamPF018528.5E-42202423IPR002913START domain
Gene3DG3DSA:3.30.530.201.5E-11261423IPR023393START-like domain
SuperFamilySSF559611.43E-11443558No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 603 aa     Download sequence    Send to blast
MDSGDEQDVP DAKGRKKRYH RHTPRQIQEL ESMFKVCPHP DEKQRMQLSR DLALEPRQIK  60
FWFQNRRTQM KASTAPPLLS FLFSLAQHDR ADNCVLRAEN DKIRAENIAM MEALKSVICP  120
SCGGPPTHED SYFDDQKLRM ENARLKEELD HVSSIASKYL GRPVTQLPPV QPVSVSSLDL  180
SVGVYSAVSE LEKPLMVEMA TGAAEEVLRL VQTDQPLWVK SGSDGRDRLQ LEIYDRMFQR  240
SGQHLRFPHT RTETSRDSAP VAMNAMTLID MFMDASKWAE LFPSIVAKAR TIEVLAAGMA  300
SSRSGSLVLM YEELQVLSPL VPTREFCFLR YCQQIESGMW VVADVSVDYP RDNQLGLSPR  360
SRRLPSGCLI EETPDGYSKI TWVEHMEIDA NDQPHVLFKD LINSGTAFGA QRWITTLRRM  420
CERFACSNVA GLPGRDLGVV SSPDGKRSMM KLAQRMVNNF CANVGASSDQ KWTNVSGSND  480
VGVRVVLQKT SDAGQPSGVV LCAATSIWLP VSAERVFSLF KDERTRTQWH ILSNGNTLQE  540
VAHITNGSHP GNCISLLRVC FLSLNTMFSL PSAKLNMESV MTVNHLIGTT VQQIKVALNC  600
ADA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009403550.10.0PREDICTED: homeobox-leucine zipper protein ROC8-like
SwissprotQ69T580.0ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLM0T4J70.0M0T4J7_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P05990_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29123770
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17920.10.0homeodomain GLABROUS 12